Extension of recurrence analysis to multidimensional time-series data, and significant update of computational procedures in crqa()
method, metric and datatypechecklSimplified structure of functions and better division between core and ancillary functions:
crqa_helpers contains several functions previously exported (e.g., theiler or tt) that are now only accessed internally by the crqa() package.New functions mdDelay() and mdFnn() to estimate Average Mutual Information and False Nearest Neighbours of multidimensional time-series.
Experimental piecewiseRQA() function created to better handle the computational load of large time-series.
optimizeParam() now works also with multidimensional time-series.
Deprecated functions: CTcrqa(), runcrqa(), calcphi(), takephi()
On crqa()
On plotRP() added arguments to improve the plotting of Recurrence Plots
drpdfromts() is now called drpfromts() and it has been rewritten to align with the new version of crqa().
A convenience function called numerify in crqa_helpers is automatically called when a user inputs categorical series (i.e., it contains either characters or factors) and this function is used to recode the levels of such time-series into numerical codes (to run crqa). A warning is send to the user when crqa().
windowdrp() has been rewritten to align with the new version of crqa().
wincrqa() has been rewritten to align with the new version of crqa() and better names for the output were provided.
drpdfromts() removed a left over constant used for testing (line: 42)drpdfromts() fixed initialisation of dimensions for empty RP (line: 52)plotRP() convenience function based on the standard plot() to visualize a Recurrence PlotOn crqa() added a few more checks (stop) if the data inputted did not comply with the function, and send a warning message.
drpdfromts() entirely rewritten around crqa() to better deal with continuous valued time-series.
runcrqa() fixed to fit with the revised functions: drpdfromts() and windowdrp(),
tt() fixed rBind (line 23 and 91) which was deprecated from the Matrix() package.
windowdrp()entirely rewritten around the new version of drpdfromts()
wincrqa() adjusted indexing of windows (line: 40:41)
ami() externalised from optimizeParam()
lorenzattractor() simulates and plots 3D data from a Lorenz Attractor
On crqa() include a stop (line: 95:100) if time-series were shorter than their phase space reconstructed portaits
On optimizeParam() included argument typeami to set the type of ami() desired (either, minimum dip or maximum lag)
On checkts(). added argument pad (line: 38:67), which gives the option, in case of series of different length to extend the shortest sequence either with mean value (if the variable is in a continuous scale) or with a random label not present in either series (if the variable is categorical).
On crqa():
side to select the region of the Recurrence Plot to extract measures oncheckl, a wrapper to call the function checkts() directly inside this function.On optimizeParam():
min.rec and max.rec to the call.par (fnnpercent) to estimate False Nearest Neighbours based on a percentage reduction with respect to first dimension (line: 199:241)On runcrqa() included argument pad in the call to work with the revised version of checkts()
On wincrqa() added calculation of TREND (line: 64:87)
DESCRIPTION (Depends field) and was resubmitted as 1.0.4.theiler() function to choose the separation between values on the time series when specifying a delay reconstruction vector, i.e., the Theiler window.On crqa() added theiler window (theiler(), line: 170:175)
On optimizeParam() improved calculation of average mutual information (line 56:119), and added estimation of radius within user specified expected recurrence values (line 237:284)
On runcrqa() added missing arguments when calling wincrqa() (line 104-110:112)
On tt() simplified calculation of laminarity (line 65)
On wincrqa() added missing arguments in the function call to exploit better functionality in crqa()
tt() added in line comments as header of function.crqa(): Implementation of embedding dimensions and phase space recostruction, added in line comments in the code.First version of the package featuring the following original functions:
calcphichecktscrqaCTcrqadrpdfromtsoptimizeParamruncrqasimtsspdiagstakephittwincrqawindowdrp